PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000261265
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 199aa    MW: 23071.2 Da    PI: 10.2338
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000261265genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding651.4e-201562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l+++++ +G+++Wk+Ia + g++R++k+c++rw +yl
    MDP0000261265 15 RGSWTAEEDQKLAQVIEIHGPRRWKSIATKAGLKRCGKSCRLRWMNYL 62
                     89********************************************97 PP

2Myb_DNA-binding50.83.9e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
    MDP0000261265  68 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 113
                      78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.8241066IPR017930Myb domain
SuperFamilySSF466891.28E-2913109IPR009057Homeodomain-like
SMARTSM007178.4E-171464IPR001005SANT/Myb domain
PfamPF002493.1E-191562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-251669IPR009057Homeodomain-like
CDDcd001673.25E-121762No hitNo description
SMARTSM007171.9E-1567115IPR001005SANT/Myb domain
PROSITE profilePS5129420.43367117IPR017930Myb domain
PfamPF002491.6E-1468113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2570118IPR009057Homeodomain-like
CDDcd001673.97E-1072113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MVPVSSRSSK KDVNRGSWTA EEDQKLAQVI EIHGPRRWKS IATKAGLKRC GKSCRLRWMN  60
YLRPNIKRGN ISDQEEDLIL RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN SHLSKKMKQN  120
RAVSKTVQGS TEQKNIKAND VNALTIERED AFKLEENFNF GFNGGQFFNC SSSEQGPLNL  180
EWMNKFLEMD ESWFTLHDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-301211724128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008393591.11e-147PREDICTED: transcription factor MYB114-like
SwissprotP102902e-52MYBC_MAIZE; Anthocyanin regulatory C1 protein
SwissprotQ9SEI01e-52WER_ARATH; Transcription factor WER
TrEMBLM5XVV31e-111M5XVV3_PRUPE; Uncharacterized protein
STRINGPOPTR_0006s23780.17e-86(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21483288
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.15e-54myb domain protein 66